PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0071ss00600.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 50aa    MW: 5583.32 Da    PI: 8.2398
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0071ss00600.5genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.53e-081445132
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg 32
                       +g+WT+ Ed++l ++++ +G g W+  +++ g
  Vang0071ss00600.5 14 KGAWTALEDKILTEYINVHGEGKWRHLPKRAG 45
                       79************************999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-11543IPR009057Homeodomain-like
SuperFamilySSF466896.16E-8845IPR009057Homeodomain-like
PROSITE profilePS5129410.052949IPR017930Myb domain
PfamPF002493.6E-61445IPR001005SANT/Myb domain
CDDcd001674.54E-41643No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 50 aa     Download sequence    Send to blast
MGRSPCCSKE GLNKGAWTAL EDKILTEYIN VHGEGKWRHL PKRAGHDYE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150424e-78AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007135450.13e-25hypothetical protein PHAVU_010G130500g
RefseqXP_014515267.13e-25PREDICTED: myb-related protein 308-like
SwissprotQ9FLR12e-15MYB29_ARATH; Transcription factor MYB29
TrEMBLA0A0L9T6S21e-25A0A0L9T6S2_PHAAN; Uncharacterized protein
STRINGGLYMA07G04240.21e-23(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28110.18e-18myb domain protein 41